Skip to main content
Have a personal or library account? Click to login
Differential expression and functional analysis of two short-chain alcohol dehydrogenases/reductases in Hedychium coronarium Cover

Differential expression and functional analysis of two short-chain alcohol dehydrogenases/reductases in Hedychium coronarium

Open Access
|May 2020

Full Article

INTRODUCTION

Hedychium coronarium is a perennial herb that belongs to the Hedychium genus of the Zingiberaceae family. The genus Hedychium approximately contains 60 species (Wu, 1994). According to the olfactory sensory evaluation, four different species of Hedychium genus were selected, namely, Hedychium coccineum Buch.- Ham (scentless), Hedychium forrestii (scentless), Hedychium gardnerianum (slightly fragrant) and H. coronarium (fragrant) (Fan et al., 2007). H. coronarium commonly grows in woodland shrubs at the altitude of 600–2,100 m, which is often cultivated as a horticultural garden plant because of its rich fragrant flowers. It can also be used in excavated medicine and aromatic oil (Wu and Raven, 2001). The volatile compounds mainly consist of monoterpenes, monoterpene derivatives, sesquiterpene and benzenoids, including linalool, (E)/(Z)-β-ocimene, 1,8-cineole, sabinene, α-thujene, myrcene, α/β-pinene, allo-ocimene, α-farnesene and β-caryophyllene at the blooming stage of H. coronarium flowers (Fan et al., 2007; Baez et al., 2011).

H. coronarium is often called a white ginger lily. Its flowers are white and not bright, but they are very fragrant. Therefore, it is an ideal material to study the secondary metabolism of horticultural plant flowers. However, there have been few research on secondary metabolism that is related to the development physiology of H. coronarium, such as fragrance, defence, etc. (Yue et al., 2014; Chen et al., 2019). Chemical constituents of the rhizomes of H. coronarium had an inhibitory effect on lipopolysaccharide-stimulated production of pro-inflammatory cytokines in bone marrow-derived dendritic cells (Kiem et al., 2011). The new full-length cDNA that encoded farnesyl diphosphate synthase from H. coronarium was possibly involved in the biosynthesis of floral and wounding/herbivory-induced leaf volatile sesquiterpenoids (Lan et al., 2013).

Furthermore, short-chain dehydrogenase/reductases (SDRs) are a gene family involved in various secondary metabolic pathways. At present, the research on cloning of SDR genes has mainly been focused on dicots, such as genus Solanum (Sonawane et al., 2018), Catharanthus roseus (Stavrinides et al., 2018), Scopolia lurida (Zhao et al., 2017), Hevea brasiliensis (Loh et al., 2016), Camellia sinensis (Zhou et al., 2015), Medicago truncatula (Pan et al., 2014), Papaver somniferum (Chen and Facchini, 2013; Ziegler et al., 2009), Lycopersicon esculentum Mill. (Moummou et al., 2012), Gossypium spp. (Pang et al., 2010), Panax ginseng (Kim et al., 2009), Solanum tuberosum L. (Keiner et al., 2002), Citrullus lanatus (Thunb.) Matsum. et Nakai (Kim et al., 2003), Arabidopsis thaliana (Cheng et al., 2002), etc., while few reports had been on monocots. The momilactone, a synthase (OsMAS/SDR110C-MS1) of Oryza sativa with the other four – all falling in the same SDR110C family, had roles in diterpenoid biosynthesis (Kitaoka et al., 2016). The first step of chlorophyll b degradation in rice can be catalysed by a membrane-localised SDR (Sato et al., 2008). Zingiber zerumbet, a member of the Zingiber genus of Zingiberaceae family, is widely cultivated throughout the tropics and the subtropics for its medicinal properties. The rhizome oil of Z. zerumbet contains a high content of sesquiter penoids with zerumbone, and ZSD1 (BAK09296.1) was cloned from Z. zerumbet and belonged to a member of the SDRs 110C subfamily (http://www.sdr-enzymes.org) which catalysed 8-hydroxy-α-humulene into zerumbone and involved in secondary metabolism, stress responses and phytosteroid biosynthesis (Okamoto et al., 2011).

The expression of SDRs in plants can be regulated with development or induced by external stimuli. For the former, SDR is often expressed at certain stages during development and in specific tissues, for example, tuber, root, glandular hair of leaves, flower and fruit (Okamoto et al., 2011; Chen et al., 2011). As for the latter, the studies have shown that the tetramer SAD of pea has at least three similar family members (SAD-A, SAD-B and SAD-C), and mRNA expression indicated that SAD expression can be induced by the environment (Scherbak et al., 2011).

Our team has obtained the whole transcriptome sequence of H. coronarium (Yue et al., 2015). Among them, there are 10 sequences of short-chain alcohol dehydrogenase/reductase (SCADH). This research analysed the transcriptome of H. coronarium to study on secondary metabolism that is related to the development physiology of H. coronarium flowers. In this study, two new short-chain alcohol dehydrogenase/reductase genes, HcADH2 and HcADH3, were cloned, respectively. In-depth analysis of expression regulation of these two genes was also performed to understand similarities and differences in the secondary metabolic function of different SDRs in H. coronarium. Meanwhile, prokaryotic expressions of recombinant HcADH2 and HcADH3 were also conducted, then different substances were added and the products were examined by GS-MS to determine the catalytic activity of the recombinant enzymes. Further studies are required to clarify their involvement in related secondary metabolic pathways of H. coronarium to lay a theoretical basis to fully understand secondary metabolism of H. coronarium.

MATERIALS AND METHODS

Plant materials used to clone the genes

H. coronarium was grown in the horticulture chamber in South China Agricultural University under natural light from April to November. The temperature (20–30°C) and the relative humidity of the atmosphere (70–80%) of the environmental conditions were suitable for H. coronarium and the plants grew well, and the full-blooming flowers were selected (Fan et al., 2007).

All plant materials were harvested, immediately frozen in liquid nitrogen and stored at −70°C for RNA isolation and quantitative real-time polymerase chain reaction (PCR). All experiments were conducted three times with independently collected plants.

Plant materials for analysis on the temporal and spatial expression of the genes

According to Yue’s methods (Yue et al., 2014), different tissues, i.e. flower, bract, leaf, stem, root and rhizome, and different floral parts, i.e. style and stigma, anther, filament, outer labellum, lateral petal, sepal, pedicel were harvested from H. coronarium for the analysis of gene expression. The development of H. coronarium flowers was divided into seven stages (40, 32, 24, 16 and 8 h pre-anthesis, 0 h anthesis and 8 h post-anthesis) (Figure 1). We selected four different species of the Hedychium genus, such as H. coccineum Buch.-Ham, H. forrestii, H. gardnerianum and H. coronarium. At present, these species of the Hedychium genus are widely cultivated in China.

Figure 1

Photographs of H. coronarium flowers in different developmental stages. −40 = 40 h pre-anthesis; −32 = 32 h pre-anthesis; −24 = 24 h pre-anthesis; −16 = 16 h pre-anthesis; −8 = 8 h pre-anthesis; 0 = 0 h anthesis; 8 = 8 h post-anthesis.

Mechanical injury treatment

According to Lan’s methods (Lan et al., 2013), the wounded leaves and control leaves (not wounded, natural leaves) were collected at 0, 3, 6, 12 and 24 h after treatment and immediately frozen in liquid nitrogen.

MeJA treatment

Methyl jasmonate (MeJA) was dissolved in a small volume of ethanol and diluted with distilled water to 300 μM (Yu et al., 2008). After spraying MeJA, the leaves were rubbed with a layer of lanolin to prevent the volatilisation of MeJA. MeJA-treated and control leaves were harvested at 0, 3, 6, 12, 18 and 24 h after treatment.

All plant materials were frozen in liquid nitrogen and stored at −70°C immediately after harvesting for future isolation of RNA and quantitative real-time PCR assays. All experiments were conducted three times with independently collected materials.

RNA isolation and reverse transcriptase PCR

Total RNA was extracted with the revised hexadecyl trimethyl ammonium bromide (CTAB) method (Zhang et al., 2010). RNA content was determined spectrophotometrically. All RNA extracts were treated with DNAse (Takara Bio. Dalian, China). Of note, 1 μg of RNA was reverse-transcribed in 20 μl final volume reaction mixture including reaction buffer, namely 20 μmol · μl−1 Rnase inhibitor, 1 mmol · l−1 dNTP, 1 μg oligo (dT)18 and reverse transcriptase (RT) (M-MLV; Takara Bio. Dalian, China) according to the manufacturer’s instructions (Li and Fan, 2011).

Cloning and sequence analysis of the target gene

Our team has obtained the whole transcriptome sequence of H. coronarium (Yue et al., 2015). Among them, there are 10 sequences of short-chain alcohol dehydrogenase (SAD), of which HcADH2 and HcADH3 are highly expressed. From the transcriptome of H. coronarium, two putative full-length SDRs sequences (comp45280_ c0 and comp41433_c0) (Table S1 in Supplementary Materials) were identified as short-chain alcohol dehydrogenase/reductase using the inquiry sequence in BLAST searches. The two genes were clustered and analysed with the known SDR genes, which showed that they were closely related to the genes involved in the secondary metabolism of H. coronarium, so these two genes were chosen to carry out further research related to the secondary metabolism of H. coronarium. Biological software Primer Premier 5.0 was used to design specific primers (Table S2 in Supplementary Materials) to clone the full cDNA sequences. The primers were synthesised by Shanghai Sangon Biological Engineering Co., Ltd. The full-length cDNAs were amplified using high-fidelity DNA polymerase KOD-Plus (TOYOBO) following the manufacturer’s recommendation. The PCR conditions were as follows: 94°C for 2 min, followed by 35 cycles at 98°C for 15 s, 55°C for 30 s, 68°C for 2 min. The product was ligated into the pMD-19 vector after the A base was added on 3' end by TaqDNA polymerase. The obtained plasmid DNA was sequenced.

The predicted protein sequences alignment was performed using the DNAssist version 2.2 software; the identity value was calculated by DNAMAN version 5.2.2 software and the construction of a phylogenetic tree was conducted by alignment on ClustalX at first, followed by neighbour-joining with MEGA software (version 5.05) (Kumar et al., 2004). The numbers at each branch indicate bootstrap percentages from 1,000 replicates. The evolutionary distances were computed using the model of Poisson correction. Positions containing gaps and missing data were eliminated. The scale bar indicates 20% sequence divergence. GenBank accession numbers are shown in Table S3 in Supplementary Materials.

An identity search for translated amino acids was conducted using the National Center for Biotechnology Information (NCBI) BLAST network server (http://www.ncbi.nlm.gov/BLAST).

Quantitative real-time PCR assays

Primers for quantitative real-time PCR were designed using Primer Premier version 5.0 (Table S4 in Supplementary Materials), and the dissolution curve suggested that only a single PCR product was amplified by each pair of primers. To ensure the specificity of the primers for amplification of the target gene, we further sequenced the PCR product of each pair of primers. GAPDH was used as the internal control gene in this study.

Real-time RT-PCR was performed in a volume of 20 μl containing SYBR Premix Ex TaqTM with an ABI 7500 real-time PCR system. The PCR conditions were as follows: 95°C for 30 s, followed by 40 cycles at 95°C for 5 s, annealing at 55°C for 30 s, elongation at 72°C for 30 s. The melting curve was designed to increase 0.4°C every 10 s from 72 to 94°C. All real-time PCR analyses were performed in triplicate with different cDNAs synthesised from three biological replicates. The amplicon was clarified using electrophoresis and sequenced once for identity confirmation. Quantification was done for the analysis of the threshold cycle (Ct) value. According to Manríquez’s methods, the relative expression ratios were quantified (Manríquez et al., 2006).

Heterologous expression of HCADH2 and HCADH3 in Escherichia coli

The entire open reading frame of HcADH2 and HcADH3 were constructed using a pET30a vector to express HcADH2 and HcADH3, respectively, as a His-tagged protein (Table S2 in Supplementary Materials). Expression, solubility analysis and purification of the target protein were performed using Yue’s methods (Yue et al., 2014). The recombinant plasmid pET30a-HcADH2 and pET30a-HcADH3 were transformed into E. coli Rosetta (DE3) competent cells (Invitrogen). Single positive colonies verified by sequencing were inoculated at 37°C overnight, shaking continuously in 5 ml Luria Bertani (LB) liquid medium supplemented with 0.1 mg · ml−1 kanamycin. Then the grown cultures were diluted 1:50 with LB medium under the same conditions as above until OD600 of 0.4–0.5 at 37°C was achieved. Cultures were then induced with 0.05 mM isopropyl-1-thio-β-d-galactoside (IPTG) and incubated for an additional 14 h at 16°C and 180 rpm with shaking. The cells were separated from the medium by centrifugation (5,000 g, 5 min, 4°C) and resuspended in 5 ml lysis buffer (50 mM NaH2PO4, pH 8.0, 300 mM NaCl, 10 mM imidazole). Cells were then sonicated three times (work 3 s with 3 s intervals at 4°C, repeated 30 times) and the resulting suspension was centrifuged at 12,000 g and 4°C for 10 min. The obtained crude extract was loaded onto a Ni-NTA His·Bind Resins (Novagen) to purify His-tagged recombinant protein according to manufacturer’s introduction. Partially purified proteins were dialysed against a buffer containing 30 mM 2-[4-(2-Hydroxyethyl)-1-piperazinyl] ethanesulfonic acid (HEPES) (pH 7.5) and 5 mM dithiothreitol (DTT). The purity of the recombinant protein from each elution was estimated using sodium dodecyl sulfate (SDS) polyacrylamide gel electrophoresis (SDS-PAGE).

Enzyme assay in vitro and production identification

The enzyme assays were performed in a total volume of 1 ml with 20 mM KH2PO4, pH 8.0, 50 μg of an enzyme, 1 mM NAD(H), 10 mM EDTA and 0.1 mM substrate. The mixture was incubated for 1 h at 37°C with shaking (60 rpm), and the reaction was immediately stopped by the extraction of ethyl acetate (150 μl).

Headspace extraction and injection were conducted using a solid-phase microextraction (SPME) Fiber Assembly 50/30 μM divinylbenzene/Carboxen™/polydimethylsiloxane (PDMS) (Stable Flex™ for manual holder grey). After incubation, the PDMS fibre was injected into a gas chromatography-mass spectrometer (GC-MS) system for analysis. The GC-MS analyses were performed using an Agilent 7980A GC/5975C MSD. The instrument was equipped with an Agilent DB-5MS capillary column (30 m × 0.25 mm) and helium as a carrier gas at a constant flow of 1 ml · min−1. The oven temperature was initially maintained at 40°C for 2 min, followed by an increase to 250°C at a rate of 5°C · min−1, and held at 250°C for 5 min. The products were identified by comparison of mass spectra and retention time with authentic standards with the NIST2008 mass spectral library. Controls were carried out in the absence of NAD(H) and an empty vector.

Headspace analysis of floral volatiles

According to Chen’s methods (Chen et al., 2019), H. coronarium flowers from each stage were enclosed in a 100 ml glass bottle with the addition of ethyl decanoate as an internal standard. The flower volatiles were absorbed by PDMS (with 50/30 μm divinylbenzene/Carboxen) fibre (Supelco) for SPME for 30 min. Then, the fibre was injected into a GC-MS system (Agilent) for analysis as is described earlier.

RESULTS

Cloning and sequence analysis of HcADH2 and HcADH3

Among the transcriptome of H. coronarium, there are 10 sequences of SAD, of which comp45280_c0 and comp41433_c0 are highly expressed. So these two clones were selected and identified as short-chain alcohol dehydrogenase/reductase. The PCR amplification was carried out to get the two genes designated as HcADH2 (MK388796.1) and HcADH3 (MK388797.1) using the full-length primer. The nucleotide sequences of 849 and 903 bp, respectively, were obtained (Figures S1 and S2 in Supplementary Materials). The full-length cDNAs of HcADH2 and HcADH3 contained putative open reading frames (ORFs) of 834 and 888 bp, which encoded 278 and 296 amino acid residues with predicted molecular weights of 29.00 and 31.08 kDa, respectively.

The TGxxx[AG]xG motif is present in the sequences of HcADH2 and HcADH3, which is highly conserved in almost all SDRs and is responsible for Rossmann-fold scaffold due to its ability to bind NAD(P) dinucleotides (Joernvall et al., 1995; Kallberg et al., 2002) (Figure 2). Both sequences have the typical motif of YxxxK at the active site (Kavanagh et al., 2008). The NAG motif is present in the sequences of HcADH3, while the NAA domain is present in the sequences of HcADH2. The NAG domain is responsible for substance specificity (Oppermann et al., 1997; Filling et al., 2002), which suggests that HcADH2 may catalyse a reaction of substances, different from HcADH3, thus playing a different role in H. coronarium. The aspartic acid at position 52 (Asp52) of HcADH2 motifs and the Asp67 of HcADH3 motifs suggest that these two enzymes may prefer NAD over NADP as a coenzyme (Kallberg et al., 2002) (Figure 2).

Figure 2

Alignment of the deduced amino acid sequences of HcADH2, HcADH3 and alcohol dehydrogenases/reductases from various plant species. RWR85228 = Cinnamomum micranthum SDR; HcADH = Hedychium coronarium SDR (KF358245); BAK09296 = Zingiber zerumbet SDR; RWR94702 = Cinnamomum micranthum secoisolariciresinol dehydrogenase. Grey boxes = identical residues; black boxes = similar residues; black triangle = the aspartate at position 52 of HcADH2 and position 67 of HcADH3. SDR, short-chain dehydrogenase/reductase.

Bioinformatics analysis of HcADH2 and HcADH3

Alignment of the amino acid sequence revealed that HcADH2 and HcADH3 share 41% identity. They exhibit high identity with SDRs from other species (Figure 2). For example, HcADH2 shows 49% sequence identity to our identified HcADH (Chen et al., 2019) of H. coronarium (Genbank KF358245), while HcADH3 shows 42% sequence identity. HcADH2 shows 59% sequence identity to SDR (Genbank RWR85228.1) and 42% sequence identity to secoisolariciresinol dehydrogenase (SDH) (Genbank RWR94702.1) of Cinnamomum micranthum f. kanehirae, while HcADH3 shows 47% and 60% sequence identity, respectively (Chaw et al., 2019). HcADH2 and HcADH3 show 49% and 43% sequence identity to the SDR of Z. zerumbet (GenBank BAK09296.1), respectively (Figure 2) (Okamoto et al., 2011).

Phylogenetic analysis

Phylogenetic analysis showed that HcADH2 and HcADH3 from H. coronarium belonged to a member of the short-chain dehydrogenases/reductases (SDRs) 110C subfamily (Figure 3). HcADH2 and our identified terpene-modified HcADH (Chen et al., 2019) were distinctly clustered in the same clade, whereas HcADH2 distinctly showed a close relationship with several known SDR, such as Musa acuminata subsp. malaccensis SDH (68% identity), C. micranthum f. kanehirae SDR (53% identity) (Chaw et al., 2019), Macleaya cordata SDR (56% identity) (Liu et al., 2017), Artemisia annua glucose/ribitol dehydrogenase (GRD) (53% identity) (Shen et al., 2018), Asparagus officinalis momilactone A synthase (MAS) (60% identity) (Figure 3). However, HcADH3 was distinctly clustered in another clade, which showed close relationship with C. micranthum f. kanehirae SDH (60% identity) (Chaw et al., 2019), O. sativa japonica group MAS (56% identity), Ricinus communis SAD (56% identity) and S. tuberosum zerumbone synthase (ZSR) (57% identity).

Figure 3

Phylogenetic tree of HcADH2 and HcADH3 with known alcohol dehydrogenase/reductase from other species. Aa = Artemisia annua; Ao = Asparagus officinalis; At = Arabidopsis thaliana; Cm = Cinnamomum micranthum; Chl = Chasmanthium latifolium; Cl = Citrullus lanatus; Cr = Catharanthus roseus; Hc = Hedychium coronarium; Le = Lycopersicon esculentum; Ma = Musa acuminate; Mc = Macleaya cordata; Mp = Mentha x piperita; Nt = Nicotiana tomentosiformis; Ol = Orthoclada laxa; Os = Oryza sativa; Pa = Parasponia andersonii; Pb = Papaver bracteatum; Pd = Phoenix dactylifera; Pm = Persicaria minor; Ps = Paeonia suffruticosa; Rc = Ricinus communis; St = Solanum tuberosum; Td = Tripsacum dactyloides; Zz = Zingiber zerumbet. Scale bars = 20% sequence differences.

Expression analysis of HcADH2 and HcADH3 genes in different tissues

The real-time RT-PCR analysis showed that HcADH2 was most highly expressed in bracts. HcADH2 was also expressed at lower levels in stem, root and rhizome, but it was almost undetectable in leaves and flowers (Figure 4A).

Figure 4

The expression analysis of HcADH2 and HcADH3 in different tissues of H. coronarium. (A) The HcADH2 relative expression analysis in different tissues using qRT-PCR. (B) The HcADH3 relative expression analysis in different tissues using qRT-PCR. (C) The HcADH3 relative expression analysis in different parts of flower using qRT-PCR. OL = outer abellum; Se = petal; LP = laterral petal; Pe = pedicel; An = anter; Fi = filament; SS = style and stigma. Numbers = ±SD (n = 3). Asterisks = statistically significant differences compared with the ones with the highest expression level (*p < 0.05; **p < 0.01).

As shown in Figure 4B, transcripts of HcADH3 were preferentially expressed in flowers, with lower expression in the stem, roots and rhizome, leaf and bract. HcADH3 transcripts were highly expressed in the lateral petal of the flower, with successively lower expression in the style and stigma, sepal, filament, outer labellum and scant expression in the pedicel and anther (Figure 4C). This result showed that different SDRs genes had differential expression patterns.

Expression analysis of HcADH2 and HcADH3 in different species

The mRNA expression of HcADH2 and HcADH3 was analysed in blooming flowers of different species in the Hedychium genus (Figure 5A). HcADH2 gene was highly expressed in no-scented H. forrestii and at a very low level in H. gardnerianum and H. coronarium. It was barely expressed in H. coccineum. The highest expression of HcADH3 was noted in the very scented H. coronarium, and only a little expression was observed in H. forrestii, H. gardnerianum and H. coccineum (Figure 5B). HcADH3 perhaps has a certain correlation with flower fragrance.

Figure 5

The expression analysis of HcADH2 (A) and HcADH3 (B) in different species of Hedychium. 1 = H. gardnerianum; 2 = H. forrestii; 3 = H. coronarium; 4 = H. coccineum Buch.–Ham. Numbers = ±SD (n = 3). Asterisks = statistically significant differences compared with the ones with the highest expression level (*p < 0.05; **p < 0.01).

Expression analysis of HcADH3 during flower development

The lifespan of a floret in a H. coronarium inflorescence is usually only 3 days. During flower development, there was almost scant expression of HcADH3 mRNA transcripts in petals at 40, 32, 24 and 16 h pre-anthesis (Figure 6). Then, the HcADH3 expression levels increased sharply at 8 h pre-anthesis (the half opening stage), peaked at this stage and then decreased with the flower development (Figure 6), while the relative terpenes volatile aroma contents also increased sharply at 8 h pre-anthesis (the half opening stage) but peaked at 0 h (the opening stage) stage and then decreased with the flower development (Figure S3 in Supplementary Materials). This may be because the gene expression comes first and the plant traits are displayed later.

Figure 6

The expression analysis of HcADH3 in different developmental stages of H. coronarium flower. −40 = 40 h pre-anthesis; −32 = 32 h pre-anthesis; −24 = 24 h pre-anthesis; −16 = 16 h pre-anthesis; −8 = 8 h pre-anthesis; 0 = anthesis (0 h); 8 = 8 h post-anthesis. Numbers = ±SD (n = 3). Asterisks = statistically significant differences compared with the ones with the highest expression level (*p < 0.05; **p < 0.01).

HcADH2- and HcADH3-induced expression by mechanical wounding and MeJA treatment in leaves

Both HcADH2 and HcADH3 tissue-specific expressions had almost no expression in leaves. Mechanical wounding and MeJA treatment caused a significant increase in HcADH2 mRNA levels in H. coronarium leaves (Figure 7A and 7B). The former exhibited a fivefold increase at 3 h in HcADH2 mRNA levels and the latter showed a 21-fold increase at 12 h compared with those in natural leaves. As shown in Figure 7C, mechanical wounding caused an irregular fluctuation in HcADH3 mRNA levels in H. coronarium leaves, while MeJA treatment induced a significant increase in HcADH3 mRNA levels which exhibited a sixfold increase at 12 h compared with those in natural leaves (Figure 7D). The results showed that HcADH2 was an inducible gene in the leaves which might play a defensive role in vegetative organs. However, HcADH3 expression can only be induced by MeJA treatment but not by mechanical wounding. This suggested that MeJA induced HcADH3 expression via the signal pathway other than injury response-related pathways.

Figure 7

Expression analysis of HcADH2 and HcADH3 mRNA levels in response to external environmental stimuli. (A) HcADH2 expression at 0–36 h after wounding. (B) HcADH2 expression analysis of MeJA treatments and natural leaves (control) at different times. (C) HcADH3 expression at 0–36 h after wounding. (D) HcADH3 expression analysis of MeJA treatments and natural leaves (control) at different times. Numbers = ±SD (n = 3). Asterisks = statistically significant differences compared with the ones with the highest expression level (*p < 0.05; **p < 0.01).

The substrate catalysis characterisation of the purified recombinant HcADH2 and HcADH3

The coding regions of HcADH2 and HcADH3 were expressed in E. coli, and their activity was analysed in vitro. The recombinant proteins of both were purified by Ni-affinity chromatography, and their activity was analysed in vitro. This experiment focused only on the selection of representatives of different structures of terpenoids as substrates, such as monoterpenoids (geraniol, camphor, linalool) and sesquiterpenoids (farnesol), for catalytic reactions (Table S5 in Supplementary Materials). The purified recombinant HcADH3 protein can convert geraniol into citral (Figure 8). However, HcADH3 could not utilise other terpenoids, including camphor, linalool and farnesol, as substrates, while purified recombinant HcADH2 protein could not catalyse geraniol, camphor, linalool and farnesol as substance. These results suggested that the coding region of HcADH3 cDNA encoded a functional alcohol dehydrogenase/reductase and might participate in dehydrogenation reactions of monoterpenoids, while recombinant HcADH2 protein could not encode or participate.

Figure 8

Analyses of products generated by the recombinant HcADH3 enzyme with geraniol as substrate. (A) Total ion chromatogram of the products obtained from the empty vector pET30a. (B) Total ion chromatogram of products obtained from pET30a-HcADH3 with NAD (peak 1, geraniol; peak 2, citral). (C) Mass spectrum of peak 2 (citral). (D) Mass spectrum of authentic citral in the NIST08 library.

DISCUSSION

SDRs are divergent NAD(H)- or NADP(H)-dependent enzymes including five major types, namely classical, extended, intermediate, divergent and complex. They have a wide range of substrate spectra (Kallberg et al., 2002). HcADH2 and HcADH3 belong to the ‘classical’ subfamily of the SDR superfamily. HcADH2 and HcADH3 are an SDR110C, identified on http://www.sdrenzymes.org (Persson et al., 2009), participating in many important secondary metabolisms (Kitaoka et al., 2016).

The temporal and spatial expression patterns of the HcADHs can provide insight into the potential roles of a short-chain alcohol dehydrogenase in H. coronarium. In higher plants, the function of the short-chain alcohol dehydrogenase gene should be related to gene expression, especially in different tissues, for example, the seeds (Kim et al., 2003), fibres, roots and stems (Pang et al., 2010). The analysis of fragrance-related gene expressions showed that petal epidermal cells had been proposed as the sites for scent production and emission (Vainstein et al., 2001). PsDFR1 showed the highest transcript abundance in petals, moderate levels in sepals and stamens, low level in leaves and the lowest level in carpels from petals of tree peony (Paeonia suffruticosa ‘Cai Hui’) (Zhou et al., 2011). The expression levels of Cucumber (Cucumis sativus L.) 18 CsSDR110C genes were different in roots, stems, leaves, male flowers, fruits and tendrils. Among these genes, the expression levels of some CsSDR110C genes can be increased in the light-induced cucumber seedlings decholorosis process (Wang, 2014). The HcADH3 gene was also highly expressed in the lateral petal of flower tissues and very low in stem, roots and rhizome, leaf and bract, which implies that HcADH3 might be a flower-related expression gene.

The expression of qRT-PCR transcript was examined at different floral developmental stages to further understand the potential role of HcADH3. In maize (Zea mays), a SDR protein, TASSELSEED2 (TS2) can regulate the unisexual flower development (Malcomber and Kellogg, 2006). There was a report on the molecular cloning of GLUCOSE INSENSITIVE1 (GIN1) and ABSCISIC ACID DEFICIENT2 (ABA2), which encoded a unique Arabidopsis SDR1. SDR1 was involved in sex determination in maize (Cheng et al., 2002). The HcADH3 expression levels peaked at 8 h pre-anthesis (the half opening stage), but the expression levels were almost scant at 40, 32, 24 and 16 h pre-anthesis. The HcADH3 was perhaps involved in related secondary metabolic pathways of H. coronarium.

In Hedychium, H. coronariums is very scented through olfactory sensory evaluation (Fan et al., 2007), but some species, such as H. coccineum and H. forrestii, have lot of ornamental traits but not scented through olfactory sensory evaluation. H. gardnerianum is with faint scent (Wu and Raven, 2001). The transcript level of HcADH in the scent species (H. coronarium) was highest, but the gene was rarely expressed in the scentless species, such as H. coccineum and H. forrestii. The change in their expression levels in different species of the Hedychium genus was positively correlated with the emission pattern of allo-ocimene (Chen et al., 2019). HcADH3 genes are highly expressed in the flower of H. coronarium, which illustrates that HcADH3 is perhaps a flower fragrance-related expression gene, while HcADH2 genes showed vastly different expression characteristics. But the reasons for the HcADHs expression difference in Hedychium remain to be further verified experimentally.

In plant defence mechanisms, mechanical injury and MeJA treatments are general methods (Walter, 1992; Weeden and Provvidenti, 1988). Two SDRs PmADHa and PmADHb were conducted under the exogenous ABA treatment and drought stress in leaves, stems and roots. Exogenous ABA treatment showed that the high expression of PmADHs was tested only in roots, whereas the expression of PmADHa and PmADHb were upregulated in response to drought stress in all organs (Hamid et al., 2018). The expression of SDR1 (unique SDR) showed the dynamic mobilisation of ABA precursors and/or ABA in Arabidopsis (Cheng et al., 2002). SalR was a member of SDRs that were active as monomers and possess an extended amino acid sequence compared with classical SDRs from the opium poppy. Amino acid residues conferring salutaridine binding non-specifically reduce (−)-menthone to (+)-neomenthol, which showed that some of these proteins are involved in plant defence (Ziegler et al., 2009). Our results suggested that treatments with mechanical wounding and MeJA in leaves of H. coronarium stimulated the expression of HcADH2, but HcADH3 expression was induced only by MeJA treatment. It is possible, therefore, that HcADH2 and HcADH3 also have a defensive function in H. coronarium vegetative organs.

Hassan et al. (2012) reported that DH I and II Polygonum minus geraniol dehydrogenase can catalyse the oxidation of geraniol to geranial, and they might be involved in monoterpene alcohol metabolism and also have their high specificity for allylic alcohols. The recombinant HcADH3 enzyme can use monoterpenoids geraniol as a catalytic substrate. No enzymatic product was synthesised from camphor, linalool or farnesol, indicating that both the number of carbon bonds of the aliphatic chain and the position of the hydroxyl group, cyclic and acyclic, are crucial for the formation of enzymatic products. This result was in agreement with the study by Hassan et al. However, differently, ZSD1 from Z. zerumbet, a member of the SDR superfamily, is involved in phytosteroid biosynthesis. ZSD1 can convert borneol to camphor (Okamoto et al., 2011). Polichuk et al. (2010) analysed that ADH2 belongs to a member of the short-chain alcohol dehydrogenase/reductase (SDR) superfamily. ADH2 showed a strong preference for monoterpenoid secondary alcohols including carveol, borneol and artemisia alcohol. The short-chain alcohol dehydrogenase/reductase GcSDR was expressed as a recombinant protein in E. coli BL21 (DE3) pLysS. Kinetic analysis of recombinant GcSDR using pyruvaldehyde dimethyl acetal as a substrate has a Km value of 116.52 mM and a Vmax value of 720 nmol product formed per minute per milligram (Naseron et al., 2014). The GLYCOALKALOID METABOLISM25 (GAME25) from tomato is a SDR and it catalyses to reduce the C-5,6 double bond in dehydrotomatidine to form tomatidine. The recombinant GAME25 enzyme displayed 3β-hydroxysteroid dehydrogenase isomerase activity on diverse steroidal alkaloid aglycone substrates and steroidal saponin aglycones (Sonawane et al., 2018). It will perhaps lay a theoretical basis to understand secondary metabolism of H. coronarium.

CONCLUSIONS

We have first identified two short-chain alcohol dehydrogenases/reductases in H. coronarium. They play different functions in H. coronarium. HcADH2 and HcADH3 have an induced expression in the vegetative organ of H. coronarium, but HcADH3 is also a flower-related expression gene and HcADH3 has catalytic activity on monoterpene and converts geraniol into citral. Our results would provide new insights into secondary metabolism of H. coronarium flowers.

Abbreviations

ADH

alcohol dehydrogenase;

GC-MS

gas chromatography-mass spectrometry;

IPTG

isopropyl-1-thio-β-d-galactoside;

MeJA

methyl jasmonate;

PAGE

polyacrylamide gel electrophoresis;

RT-PCR

reverse transcription polymerase chain reaction.

Notes

[1] NOTES

The nucleotide sequence reported in this article has been submitted to GenBank database with accession number, HcADH2 = MK388796.1 and HcADH3 = MK388797.1.

[2] FUNDING

This work was supported in part by the National Natural Science Foundation of China to Yanping Fan (Grant No. 30972026, 31370694), the National Natural Science Foundation of China to Hua Chen (Grant No. 31600573), the Key platform and scientific research project of Guangdong Education Department to Hua Chen (Grant No. 2017KTSCX196), Key Laboratory of Innovation and Utilization for Germplasm Resources in Horticultural Crops in Southern China of Guangdong Higher Education Institutes, South China Agricultural University (Grant No. KBL11008) and a Specialized Research Fund for the Doctoral Program of Higher Education of China to Yanping Fan (Grant No. 20134404110016).

[3] Contributed by AUTHOR CONTRIBUTIONS

H.C. contributed to all experiments and manuscript preparation. H.C. and Y.F. designed the overall study. Y.Y. performed collection of headspace volatiles and GC-MS analysis. R.Y. performed quantitative real-time PCR assays. Y.F., Y.Y. and R.Y. helped develop the manuscript text.

[4] Conflicts of interest CONFLICT OF INTEREST

The authors declare no conflict of interest.

SUPPLEMENTARY MATERIALS

Figure S1

The RT-PCR amplification products of HcADH2 and HcADH3. M = DNA DL 2000 Marker; 1 = HcADH2 PCR product; 2 = HcADH3 PCR product.

Figure S2

Full-length sequence of HcADH2 and HcADH3 genes. Nucleotide sequences with green colour = the primer sequences for full cDNA synthesis. Nucleotide sequences with red colour = initiator codon (ATG), terminators (TGA).

Figure S3

Relative terpenes volatile aroma contents of Hedychium coronarium during flower development. Numbers = ± SD (n = 3). Asterisks = statistically significant differences compared with the ones with the highest expression level (*p < 0.05; **p < 0.01).

Table S1

Amino acid residues sequences of comp45280_c0 and comp41433_c0

NameAmino acid residue sequences
comp45280_c0MAADGSNGNAVPASPSRRLEGKV
AFITGGAAGSGEATARLFVLHGAK
VVIGDVRDEFGRAAASSIGGEDVIT
YVHCDVSKEADVERAVDLAVAKY
GRLDIVFSNAAVLDECRGVAVAEA
DDFDRVMAVNVRGVFLGTKHAAR
AMMAAGVRGSIINNGSVATVVAG
VASHAYVASKHAVLGLTRSAAAEL
GQHGIRVNCVSPFAYATSLACDFIH
MDQKQIEQFIGAVSNLKGAVLRAD
DVARAAVYLASDESCYVSGQNIII
DGGFTAVNHAFGLFKN
comp41433_c0MLGMALRVKRGLAIRTGIRTQQQQFSTH
PTPARLAGKVAIITGAASGVGRATAAEFI
HHGAQVVLADIQHELGKSVAAELGPGAT
FVPCDVTQEPQVAAVVDLAVAKHGRLDI
MYNNAGICGPMTFAVTDVDLTEFDRVM
AVNVRSVVAGIKHAARVMIPRRAGSILC
TASITGFVGGLAPLAYSLSKAAVAAAVRL
SAAELSKHGIRVNCISPASLPTPFGIKAIRE
ILPDLEEQRAVEMIELSSAELAGTKCEVED
VAKAATFLASDEAKYISGHNLMVDGGFT
TSKRLNFSPE
Table S2

Primer sequences of HcADH2 and HcADH3 used in RT-PCR assays

MethodsForward primerReverse primerPCR product size (bp)
RT PCRHcADH2TCTTCCACTCAGATGGCGGCTTCAGTTCTTGAAGAGGCCAAA849
HcADH3TTGACAGAAACCATGCTCGGAATTCACTCTGGTGAAAAATTTAAGCG903
PET-30a:HcADH2 vectorCGCGGATCCATGGCGGCTGACGGCCCAAGCTTTCAGTTCTTGAAGAGGCCAAAG
PET-30a:HcADH3 vectorCGCGGATCCATGCTCGGAATGCCCAAGCTTTCACTCTGGTGAAAAAT
Table S3

Sequences description of accession numbers in GenBank on the phylogenetic tree

Accession numbersName
AAB57737.1Short-chain alcohol dehydrogenase
AAM10204.1Tropinone reductase
AAU20370.1Secoisolaticiresinol dehydrogenase
AB018559.1Short-chain alcohol dehydrogenase
ACZ34296.1Short-chain alcohol dehydrogenase/reductase
AJO70763.1Alcohol dehydrogenase
AK103462.1Short-chain alcohol dehydrogenase/reductase
BAG96093.1Short-chain alcohol dehydrogenase/reductase
BAG99023.1Short-chain alcohol dehydrogenase/reductase
BAK09296.1Short-chain alcohol dehydrogenase/reductase
DQ384222.1Short-chain dehydrogenase/reductase
DQ384263.1Short-chain dehydrogenase/reductase
EEF41657.1Short chain alcohol dehydrogenase
EF184229.1Salutaridine reductase
HQ283448.1Dihydroflavonol 4-reductase
KF358245Short-chain dehydrogenase/reductase
KM515811.1Short-chain dehydrogenase/reductase
KM515812.1Short-chain dehydrogenase/reductase
NP_001233856.1Short-chain dehydrogenase/reductase
OVA14417.1Short-chain dehydrogenase/reductase
PON43718.1Short-chain dehydrogenase/reductase
PWA82834.1Glucose/ribitol dehydrogenase
RWR74505.1Short-chain dehydrogenase/reductase
RWR85228.1Short-chain dehydrogenase/reductase
RWR94702.1Secoisolaticiresinol dehydrogenase
XP_006366369.1Zerumbone synthase
XP_008811702.1Momilactone A synthase
XP_009404353.1Secoisolariciresinol dehydrogenase
XP_009587781.1Short-chain dehydrogenase/reductase
XP_015645551.1Momilactone A synthase
XP_018675432.1Secoisolariciresinol dehydrogenase
XP_020246099.1Momilactone A synthase
Table S4

Primer sequences used in quantitative real-time PCR assays and their characteristics

Gene namePrimer (forward/reverse) 5′→3′Amplicon Tm (°C)Amplicon length (bp)Amplication efficiency (%)R2
GAPDHTAACATCATTCCCAGCAGCACT
GGTGGATCTCACTGTCAGGCTC
83.2013694.80.998
HcADH2TGCTACGTCAGCGGACAGAAC
GGACCGTCACCGACATAAGG
90.7112879.40.991
HcADH3GTCAGTGGTGGCAGGGAT
CAGAGAATAGGCGAGCGG
85.712499.70.988
Table S5

Substrate of enzyme catalysed reaction

SubstrateNumber of carbonStructure
GeraniolC10graphic/j_fhort-2020-0010_ingr_001.png
FarnesolC15graphic/j_fhort-2020-0010_ingr_002.png
l-LinaloolC10graphic/j_fhort-2020-0010_ingr_003.png
CamphorC10graphic/j_fhort-2020-0010_ingr_004.png
DOI: https://doi.org/10.2478/fhort-2020-0010 | Journal eISSN: 2083-5965 | Journal ISSN: 0867-1761
Language: English
Page range: 97 - 114
Submitted on: Jan 30, 2020
Accepted on: Apr 14, 2020
Published on: May 18, 2020
Published by: Polish Society for Horticultural Sciences (PSHS)
In partnership with: Paradigm Publishing Services
Publication frequency: 2 issues per year
Related subjects:

© 2020 Hua Chen, Yuechong Yue, Rangcai Yu, Yanping Fan, published by Polish Society for Horticultural Sciences (PSHS)
This work is licensed under the Creative Commons Attribution-NonCommercial-NoDerivatives 3.0 License.